Protein Info for MCAODC_02375 in Escherichia coli ECRC101
Name: pyrI
Annotation: aspartate carbamoyltransferase regulatory subunit
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to PYRI_ECODH: Aspartate carbamoyltransferase regulatory chain (pyrI) from Escherichia coli (strain K12 / DH10B)
KEGG orthology group: K00610, aspartate carbamoyltransferase regulatory subunit (inferred from 100% identity to eco:b4244)MetaCyc: 100% identical to aspartate carbamoyltransferase, PyrI subunit (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Aspartate carbamoyltransferase regulatory chain (PyrI)" in subsystem De Novo Pyrimidine Synthesis
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
- superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
- UMP biosynthesis I (6/6 steps found)
- UMP biosynthesis II (6/6 steps found)
- UMP biosynthesis III (5/6 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (153 amino acids)
>MCAODC_02375 aspartate carbamoyltransferase regulatory subunit (Escherichia coli ECRC101) MTHDNKLQVEAIKRGTVIDHIPAQIGFKLLSLFKLTETDQRITIGLNLPSGEMGRKDLIK IENTFLSEDQVDQLALYAPQATVNRIDNYEVVGKSRPSLPERIDNVLVCPNSNCISHAEP VSSSFAVRKRANDIALKCKYCEKEFSHNVVLAN