Protein Info for MCAODC_02355 in Escherichia coli ECRC101

Name: bdcR
Annotation: HTH-type transcriptional repressor BdcR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 PF00440: TetR_N" amino acids 23 to 66 (44 residues), 48.7 bits, see alignment 2.7e-17

Best Hits

Swiss-Prot: 95% identical to BDCR_ECOLI: HTH-type transcriptional repressor BdcR (bdcR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eok:G2583_5081)

Predicted SEED Role

"Putative HTH-type transcriptional regulator YjgJ, TetR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (197 amino acids)

>MCAODC_02355 HTH-type transcriptional repressor BdcR (Escherichia coli ECRC101)
MVTKKQSRVPGRPRRFAPEQAVSAAKVLFHQKGFDAVSVAEVTDYLGINPPSLYAAFGSK
AGLFSRVLNEYVGTEAIPLVDILRDDRPVGECLAEVLKEAARRYSQNGGCAGCMVLEGIH
SHDPQARDIAVQYYHAAETAIYDYIARLHPQSAQCVTDFMSTVMSGLSAKAREGHSLEQL
CATAALAGEAIKTILKE