Protein Info for MCAODC_02170 in Escherichia coli ECRC101

Name: uvrD
Annotation: DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 704 PF00580: UvrD-helicase" amino acids 241 to 490 (250 residues), 82.6 bits, see alignment E=7.8e-27 PF13245: AAA_19" amino acids 251 to 490 (240 residues), 52.6 bits, see alignment E=1.1e-17 PF13361: UvrD_C" amino acids 509 to 615 (107 residues), 31.3 bits, see alignment E=3e-11 amino acids 620 to 693 (74 residues), 49.8 bits, see alignment E=7.3e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to ecf:ECH74115_5811)

Predicted SEED Role

"putative DNA helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (704 amino acids)

>MCAODC_02170 DNA helicase (Escherichia coli ECRC101)
MTVQTPKVALSDGFLGAFARIPKAQQKKVQEFISKFRQDPTSNGLNYEKIHDARSKNVHS
VRIDQTYRGIVLKPEQGALYMLMWVDKHDEAYDWARRHDCSIHPVTGAIQVIDISYIKPA
AETVVDKPKLFAAYSAEQILALGVPPVFIDQVMALTDEAGLNQLESIMPAEAWEPLHWLA
EGLDYQEVLEEFNDHRDEPVDTNDFMEAIERSKRRFHVVENEQELLQMLNAPLEKWRVFL
HPSQRKLVESPANGPVRVLGGAGTGKTVVAMHRARWLSQRLADKPGKKVLFTTFTRNLAA
DIRANLQRLCTREEMARIDVVNIDAWMSDQLKRHGYDFRVVYDSDEGRRKCWNYALQQAP
AELGLPDNFYAEEWQRVVQPNAVYTREEYLKVSRVGRGTALSRIQRAKIWPVFEEFRAQM
ARAKLREMGDAMHEAIVLFKEKQVQLPYSSIVVDEAQDIGAPAFTLIRSLVPESPNDLFI
VGDGHQRIYRNKVVLGQCGINVRGRRSKKLKINYRTTEETRQFAVGLLTGVKVDNLDGEA
DTSNDYLSLLHGEKPMITHAADFKEEAATLVKQIQALLANQVRSQDICITARTKHACDRY
ASALNDAGIETFNLGNDSGDSDARPGVRVATMHRIKGLEFQYVFLVGINEGVVPEIKALA
SDDPVEQRDALFNERALLHVAATRAVKGLFVSSSGVPSPLLVAD