Protein Info for MCAODC_02120 in Escherichia coli ECRC101

Name: fimA
Annotation: Type-1 fimbrial protein, A chain precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00419: Fimbrial" amino acids 33 to 182 (150 residues), 113.1 bits, see alignment E=7.6e-37

Best Hits

Swiss-Prot: 97% identical to FIMA1_ECOLI: Type-1 fimbrial protein, A chain (fimA) from Escherichia coli (strain K12)

KEGG orthology group: K07345, major type 1 subunit fimbrin (pilin) (inferred from 100% identity to ecs:ECs5273)

Predicted SEED Role

"type 1 fimbriae major subunit FimA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>MCAODC_02120 Type-1 fimbrial protein, A chain precursor (Escherichia coli ECRC101)
MKIKTLAIVVLSALSLSSTAALAAATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQV
RTASLAQDGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSAT
NVGVQILDRTGAALTLDGATFSEQTTLNNGTNTIPFQARYYAIGEATPGAANADATFKVQ
YQ