Protein Info for MCAODC_01975 in Escherichia coli ECRC101

Name: rpnD
Annotation: Recombination-promoting nuclease RpnD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF04754: Transposase_31" amino acids 8 to 210 (203 residues), 298.5 bits, see alignment E=1.2e-93 TIGR01784: conserved hypothetical protein" amino acids 9 to 250 (242 residues), 141 bits, see alignment E=3.2e-45

Best Hits

Swiss-Prot: 100% identical to RPND_ECO57: Recombination-promoting nuclease RpnD (rpnD) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to ecs:ECs5301)

MetaCyc: 61% identical to recombination-promoting nuclease RpnA (Escherichia coli K-12 substr. MG1655)
RXN0-7100

Predicted SEED Role

"FIG00638024: Transposase ECs5301"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>MCAODC_01975 Recombination-promoting nuclease RpnD (Escherichia coli ECRC101)
MTNFTTSTPHDALFKSFLMHPDTARDFMEIHLPKDLRELCDLDSLKLESASFVDEKLRAL
HSDILWSVKTREGDGYIYVVIEHQSREDIHMAFRLMRYSMAVMQRHIEHDKRRPLPLVIP
MLFYHGSRSPYPWSLCWLDEFADPTTARKLYNAAFPLVDITVVPDDEIVQHRRVALLELI
QKHIRQRDLMGLIDQLVVLLVTECANDSQITALLNYILLTGDEERFNEFISELTSRMPQH
RERIMTIAERIHNDDCRANS