Protein Info for MCAODC_01575 in Escherichia coli ECRC101

Name: yaaI
Annotation: DUF2541 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF10807: DUF2541" amino acids 3 to 132 (130 residues), 242.4 bits, see alignment E=5e-77

Best Hits

Swiss-Prot: 100% identical to YAAI_ECO5E: UPF0412 protein YaaI (yaaI) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: None (inferred from 98% identity to eco:b0013)

Predicted SEED Role

"FIG00638537: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (134 amino acids)

>MCAODC_01575 DUF2541 domain-containing protein (Escherichia coli ECRC101)
MKSVFTISASLAISLMLCCTAQANDHKLLGVIAMPRNETNALALKLPVCRIVKRIQLSAD
HGDLQLSGASVYFKAARSASQSLNIPSEIKEGQTTDWININSDNDNKRCVSKITFSGHTV
NSSDMATLKIIGDD