Protein Info for MCAODC_01410 in Escherichia coli ECRC101

Name: fixA
Annotation: Protein FixA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF01012: ETF" amino acids 29 to 210 (182 residues), 129 bits, see alignment E=9.1e-42

Best Hits

Swiss-Prot: 100% identical to FIXA_ECO24: Protein FixA (fixA) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: K03521, electron transfer flavoprotein beta subunit (inferred from 100% identity to eco:b0041)

Predicted SEED Role

"Electron transfer flavoprotein, beta subunit FixA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>MCAODC_01410 Protein FixA (Escherichia coli ECRC101)
MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAAEAQVTAL
SVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQQTASALAAAAQKAGFDLILCGD
GSSDLYAQQVGLLVGEILNIPAVNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAV
STDINSPQIPSMKAILGAAKKPVQVWSAADIGFNAEAAWSEQQVAAPKQRERQRIVIEGD
GEEQIAAFAENLRKVI