Protein Info for MCAODC_01405 in Escherichia coli ECRC101

Name: fixB
Annotation: electron transfer flavoprotein subunit alpha/FixB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF01012: ETF" amino acids 24 to 169 (146 residues), 60.6 bits, see alignment E=1.8e-20 PF00766: ETF_alpha" amino acids 191 to 271 (81 residues), 102.5 bits, see alignment E=9.9e-34

Best Hits

Swiss-Prot: 100% identical to FIXB_ECO57: Protein FixB (fixB) from Escherichia coli O157:H7

KEGG orthology group: K03522, electron transfer flavoprotein alpha subunit (inferred from 99% identity to eco:b0042)

Predicted SEED Role

"Electron transfer flavoprotein, alpha subunit FixB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>MCAODC_01405 electron transfer flavoprotein subunit alpha/FixB family protein (Escherichia coli ECRC101)
MNTFSQVWVFSDTPSRLPELMNGAQALANQINAFVLNDADGAQAIQLGANHVWKLNGKPD
DRMIEDYASVMADTIRQHGADGLVLLPNTRRGKLLAAKLGYRLKAAVSNDASTVSVQDGK
ATVKHMVYGGLAIGEERIATPYAVLTISSGTFDAAQPDASRTGETHTVEWQAPAVAITRT
ATQARQSNSVDLDKARLVVSVGRGIGSKENIALAEQLCKAIGAELACSRPVAENEKWMEH
ERYVGISNLMLKPELYLAVGISGQIQHMVGANASQTIFAINKDKNAPIFQYADYGIVGDA
VKILPALTAALAR