Protein Info for MCAODC_01050 in Escherichia coli ECRC101

Name: ppdD
Annotation: prepilin peptidase-dependent pilin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details PF07963: N_methyl" amino acids 1 to 25 (25 residues), 39.5 bits, see alignment 1.4e-14 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 4 to 27 (24 residues), 35 bits, see alignment 4e-13

Best Hits

Swiss-Prot: 99% identical to PPDD_ECOLI: Prepilin peptidase-dependent protein D (ppdD) from Escherichia coli (strain K12)

KEGG orthology group: K02682, prepilin peptidase dependent protein D (inferred from 99% identity to eco:b0108)

Predicted SEED Role

"Type IV pilin PilA" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (146 amino acids)

>MCAODC_01050 prepilin peptidase-dependent pilin (Escherichia coli ECRC101)
MDKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQTFVPYRTAVELCALEH
GGLDTCDGGSNGIPSPTTTRYVSAMSVAKGVVSLTGQESLNGLSVVMTPGWDNANGVTGW
ARNCNIQSDSALQQACEDVFRFDDAN