Protein Info for MCAODC_00585 in Escherichia coli ECRC101

Name: tsaA
Annotation: tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 TIGR00104: tRNA-Thr(GGU) m(6)t(6)A37 methyltransferase TsaA" amino acids 1 to 149 (149 residues), 206.8 bits, see alignment E=7.6e-66 PF01980: TrmO" amino acids 22 to 141 (120 residues), 146.4 bits, see alignment E=4.4e-47 PF18389: TrmO_C" amino acids 160 to 223 (64 residues), 83.2 bits, see alignment E=1.2e-27

Best Hits

Swiss-Prot: 100% identical to TRMO_ECOLI: tRNA (adenine(37)-N6)-methyltransferase (trmO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0195)

MetaCyc: 100% identical to tRNA m6t6A37 methyltransferase (Escherichia coli K-12 substr. MG1655)
2.1.1.-

Predicted SEED Role

"COG1720: Uncharacterized conserved protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>MCAODC_00585 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO (Escherichia coli ECRC101)
MSSFQFEQIGVIRSPYKEKFAVPRQPGLVKSANGELHLIAPYNQADAVRGLEAFSHLWIL
FVFHQTMEGGWRPTVRPPRLGGNARMGVFATRSTFRPNPIGMSLVELKEVVCHKDCVILK
LGSLDLVDGTPVVDIKPYLPFAESLPDASASYAQSAPAAEMAVSFTAEVEKQLLTLEKRY
PQLTLFIREVLAQDPRPAYRKGEETGKTYAVWLHDFNVRWRVTDAGFEVFALEPR