Protein Info for MCAODC_00350 in Escherichia coli ECRC101

Annotation: Ankyrin repeat containing virulence factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF12796: Ank_2" amino acids 5 to 82 (78 residues), 45.5 bits, see alignment E=2.4e-15 amino acids 25 to 109 (85 residues), 51.6 bits, see alignment E=2.8e-17 amino acids 146 to 230 (85 residues), 38.1 bits, see alignment E=4.6e-13 PF13637: Ank_4" amino acids 22 to 72 (51 residues), 33 bits, see alignment E=1.5e-11 amino acids 144 to 197 (54 residues), 34.2 bits, see alignment E=6.1e-12 PF13857: Ank_5" amino acids 38 to 92 (55 residues), 38.8 bits, see alignment E=2.3e-13 amino acids 162 to 217 (56 residues), 39 bits, see alignment E=2e-13 PF00023: Ank" amino acids 52 to 82 (31 residues), 28.4 bits, see alignment 3.4e-10 amino acids 178 to 204 (27 residues), 22.1 bits, see alignment (E = 3.5e-08) PF13606: Ank_3" amino acids 52 to 79 (28 residues), 20.7 bits, see alignment (E = 1.1e-07) amino acids 178 to 204 (27 residues), 21.6 bits, see alignment (E = 5.1e-08)

Best Hits

KEGG orthology group: None (inferred from 100% identity to etw:ECSP_0242)

Predicted SEED Role

"tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>MCAODC_00350 Ankyrin repeat containing virulence factor (Escherichia coli ECRC101)
MNCLIFFKPKNYHLKSKLNYYPITQAAFLGETEVVSNLIKLGVDLDARGDLGRTALNEAV
SNGYFDIVKLLVESGADLTIKDEFGKTALELAEVHQNYKIVEWLSHYRDHNPIPDFSVLI
NIYGERYFGGEIIDTDARTELGEGVLHIAVRKRRQLDVRCFIQHGADINAKANNGFDFTP
LHYSIGIGDFDMMKLLLKLGADIYLESEMGYSPMDLAILMGDKRIIFYLYGYISHVSE