Protein Info for M666_RS05290 in Cellulophaga baltica 18

Annotation: multidrug efflux SMR transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details PF00893: Multi_Drug_Res" amino acids 1 to 95 (95 residues), 86.1 bits, see alignment E=9.4e-29

Best Hits

KEGG orthology group: K11741, quaternary ammonium compound-resistance protein SugE (inferred from 85% identity to cao:Celal_1524)

Predicted SEED Role

"Quaternary ammonium compound-resistance protein SugE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>M666_RS05290 multidrug efflux SMR transporter (Cellulophaga baltica 18)
MNWILLVIAGLFEIAFAFCLGKTKDTTGAEMYWWYVGFLICATTSFLLLIYSIRSLPIGT
AYAVWTGIGAVGTVLIGILVFKEPANFWRIFFISTLIISIVGLKAVAK