Protein Info for M666_RS02430 in Cellulophaga baltica 18

Annotation: ComEC/Rec2 family competence protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 672 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 49 (19 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details amino acids 285 to 301 (17 residues), see Phobius details amino acids 307 to 323 (17 residues), see Phobius details amino acids 330 to 349 (20 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details amino acids 384 to 406 (23 residues), see Phobius details amino acids 412 to 438 (27 residues), see Phobius details amino acids 446 to 466 (21 residues), see Phobius details amino acids 476 to 497 (22 residues), see Phobius details amino acids 504 to 523 (20 residues), see Phobius details PF13567: DUF4131" amino acids 31 to 188 (158 residues), 65.7 bits, see alignment E=4.3e-22 PF03772: Competence" amino acids 230 to 496 (267 residues), 204.7 bits, see alignment E=1.9e-64 TIGR00360: ComEC/Rec2-related protein" amino acids 252 to 428 (177 residues), 92.3 bits, see alignment E=2.2e-30

Best Hits

KEGG orthology group: K02238, competence protein ComEC (inferred from 71% identity to cao:Celal_0916)

Predicted SEED Role

"Competence protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (672 amino acids)

>M666_RS02430 ComEC/Rec2 family competence protein (Cellulophaga baltica 18)
MKLLKFVPIKLTLFLVAGILFGRIIETSISIPLIATVSTLIVVAILLYTTRKIKSVLFGS
AALLLTSCIGFLAITLANPINTPNHYTKISNTGSKELRIKITEVLKPNSFSRRYFATILE
ADKRRTTGKIILSIKKDSSSQGLKVDDELITFNTLSSVKAPLNPHQFNYKKYLKGLDVYD
QLYATSAEYILLKDSKSTLYGHAAHWRTTIIGKLKEQNFNPENLSVIQALLLGQRNDISE
ETYDNYKDAGAIHILALSGLHIGILLLILQFLLQPLERLPHGKKIKLVVILLFLWSFALL
AGLSASIVRAVTMFSFLAYAMFLNRPTNSFNILALSLFFILLIQPNYLFQVGFQMSYAAV
FAILWIYPMLQRFWFPKNKIVKYFWQLLSVSIAAQLGVLPISLFYFHQFPGLFFVANLLI
IPFLGIILGIGIVIIILSLTNTLPAFVADAYNTILSYMNFIVRWIAHQDTFVFKGISFDT
VQLLVLYSLTFLIVIAFSSKRHKVIVAFLIGLIALQSYTFFLKYKASTTYESMVLHQSRA
TGILEKTGTNLHLLSTNATAFEYTLKNYQIEERIETFAIDTLRNSYLLEGKRIAIIDSLG
IYPSHKHSTILLTQSPNLNLERLIDSIQPLELIADGSNYRSDVARWKATCIKRKLPFHDT
GEKGAYYLKQKD