Protein Info for LU632_RS25895 in Erwinia tracheiphila SCR3

Annotation: lytic transglycosylase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01464: SLT" amino acids 23 to 141 (119 residues), 92.8 bits, see alignment E=5.5e-31

Best Hits

Swiss-Prot: 38% identical to IPGF_SHIFL: Protein IpgF (ipgF) from Shigella flexneri

KEGG orthology group: None (inferred from 57% identity to enc:ECL_00422)

Predicted SEED Role

"IncI1 plasmid conjugative transfer putative membrane protein PilT" in subsystem Type 4 conjugative transfer system, IncI1 type

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>LU632_RS25895 lytic transglycosylase domain-containing protein (Erwinia tracheiphila SCR3)
MRLIKSLILVAVCLCSMNASAFCFVQAGERYHLDPMLLEAIAMQESSLNPRITNDNGPRL
GKDYGLMQINSRHIPELVRMGVIRSPQDLLNDPCLNVQIGAWILARHLRTCGVNWHCLGS
YNAGFSDKNAGKREHYANLIYNLYIRVNRSQKITG