Protein Info for LU632_RS25495 in Erwinia tracheiphila SCR3

Annotation: type II toxin-antitoxin system MqsA family antitoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 PF15731: MqsA_antitoxin" amino acids 20 to 100 (81 residues), 37 bits, see alignment E=5.2e-13 PF13560: HTH_31" amino acids 44 to 86 (43 residues), 28.1 bits, see alignment E=3.1e-10 PF01381: HTH_3" amino acids 45 to 87 (43 residues), 32 bits, see alignment E=1.5e-11

Best Hits

Swiss-Prot: 47% identical to HIGA2_VIBCH: Antitoxin HigA-2 (higA-2) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K07726, putative transcriptional regulator (inferred from 90% identity to pva:Pvag_pPag30463)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (104 amino acids)

>LU632_RS25495 type II toxin-antitoxin system MqsA family antitoxin (Erwinia tracheiphila SCR3)
MNERDIYSELMTGMQELKDHQDGKITLKTYKVSKREPVTIAPQELRDVREKLNLSQAVFA
HYLHTGETTYQNWEQGRARPNAQAVLLIRMVQQNPETLQTLAQL