Protein Info for LU632_RS25250 in Erwinia tracheiphila SCR3

Name: gspI
Annotation: type II secretion system minor pseudopilin GspI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 transmembrane" amino acids 18 to 42 (25 residues), see Phobius details TIGR01707: type II secretion system protein I" amino acids 17 to 112 (96 residues), 59.8 bits, see alignment E=1.5e-20 PF02501: T2SSI" amino acids 51 to 128 (78 residues), 67 bits, see alignment E=6.6e-23

Best Hits

KEGG orthology group: K02458, general secretion pathway protein I (inferred from 38% identity to dda:Dd703_1475)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (131 amino acids)

>LU632_RS25250 type II secretion system minor pseudopilin GspI (Erwinia tracheiphila SCR3)
MTECSATTATLASGQRGIVLLEILVALVILAVTGSEVICFAAQQLTLISQLKATLYAGWV
ADNQLVQLHLSPGPRTREWVQGENLMGGRSWRWRYRYADSSVRGVDTLEIEVFRPGDRSS
LVSVNTLVVAQ