Protein Info for LU632_RS25230 in Erwinia tracheiphila SCR3

Name: gspD
Annotation: type II secretion system secretin GspD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 733 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details TIGR02517: type II secretion system protein D" amino acids 60 to 679 (620 residues), 486.4 bits, see alignment E=6.3e-150 PF21305: type_II_gspD_N0" amino acids 61 to 129 (69 residues), 84.4 bits, see alignment E=6.2e-28 PF03958: Secretin_N" amino acids 154 to 215 (62 residues), 37.1 bits, see alignment 4.6e-13 amino acids 222 to 293 (72 residues), 28.3 bits, see alignment E=2.5e-10 amino acids 302 to 426 (125 residues), 48.4 bits, see alignment E=1.4e-16 PF00263: Secretin" amino acids 505 to 671 (167 residues), 161.8 bits, see alignment E=1.7e-51

Best Hits

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (733 amino acids)

>LU632_RS25230 type II secretion system secretin GspD (Erwinia tracheiphila SCR3)
MIFMDNIISSKNRGLLSVVFYSCFLFTHFACNEAAAASMEIGPSPDNTANSVVTPRFTAA
FKNTDIREFINIVSKNLHKTIIIDSHVQGEVSVHSYEQLTADQYYQFFLNVLEVYGYTVI
TNSDNILKVVPSEKGERAALTAQKKKLNGAEIVVRIVPMQNLSGDSLAPILDKFNNNMGV
GSVRYYKPGNSLLITGRADEVRTLEAIVLDLDKNSSNRTSVDIIPVRNTKPSVIKKAVTD
IYSSSDDSSADSSADSEFSRPKLVAEDQAKVLLVNGTDKARQTVRSIIARLDKVANAKDN
SKVIFLKYTDAVDMAKLLSSYGGTNNDSDHNVQNAGDVGTGTGSSDGEHAQNDSSSNFGE
QNQFLSNNSTQFSSDYGSSLNSGSPIFEGASVHADKANNALVVHAPEEEMREIESIINKL
DIRRNQVLVEAIIVEIQDADGLNLGVSWANALGGGFGYNSDGDSNRVTRAANGFGENQPI
ASALKESGGLVAGFYHGNWGFLFSALESNKHNNILATPSIVTLDNRQAEFNVGQDIPILT
GSQTTNSDNIFNTVERRTVGFKFKIRSMIDQGNTVQLYISQEISSLTDANTANIDSKLGA
VFNIRTVNNVVQVENGETVVIGGLLDKEQNNRVSKVPLLGDIPWIGGLFRYTSHNDTKRN
LMLFIRPHIIRVQDRYNDFTASQYASFKEDQQKDNPELVKSLEPHLSGRSASSRESIAHI
QSNIAEFAREVAE