Protein Info for LU632_RS24810 in Erwinia tracheiphila SCR3

Name: rsmG
Annotation: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 PF02527: GidB" amino acids 20 to 200 (181 residues), 205.1 bits, see alignment E=3e-65 TIGR00138: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG" amino acids 26 to 202 (177 residues), 180.4 bits, see alignment E=1.4e-57

Best Hits

Swiss-Prot: 78% identical to RSMG_ERWT9: Ribosomal RNA small subunit methyltransferase G (rsmG) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K03501, ribosomal RNA small subunit methyltransferase G [EC: 2.1.1.170] (inferred from 76% identity to ebi:EbC_45950)

MetaCyc: 71% identical to 16S rRNA m7G527 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11578 [EC: 2.1.1.170]

Predicted SEED Role

"rRNA small subunit 7-methylguanosine (m7G) methyltransferase GidB"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.170

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>LU632_RS24810 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG (Erwinia tracheiphila SCR3)
MITELSSLLEQAGLSLSDRQIAQLAGYVTLLYKWNKAYNLTSVRDPQQMLIRHILDSIVV
EPHLQGNHFIDVGTGPGLPGIPLAIVRPGAHFTLLDSLGKRIRFLKQVQHELQIGNITLV
QSRVEGFHANPFFDGVISRAFASLNDMLNWCHHLPAQRGVFYALKGMLPEDEISALPAGF
ILNRVIKLSVPRLEEERHLVVINPPA