Protein Info for LU632_RS24130 in Erwinia tracheiphila SCR3

Name: yigB
Annotation: 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YigB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00702: Hydrolase
  • amino acids 11 to 196 (186 residues), 64.6 bits, E=2.4e-21
• PF13419: HAD_2
  • amino acids 15 to 206 (192 residues), 46.3 bits, E=8.5e-16
• TIGR01549: HAD hydrolase, family IA, variant 1
  • amino acids 113 to 197 (85 residues), 36.9 bits, E=4.7e-13
• PF13242: Hydrolase_like
  • amino acids 162 to 207 (46 residues), 32.6 bits, 8.9e-12

Best Hits

Swiss-Prot: 62% identical to YIGB_SHIFL: Flavin mononucleotide phosphatase YigB (yigB) from Shigella flexneri

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 78% identity to ebi:EbC_02150)

MetaCyc: 62% identical to 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase (Escherichia coli K-12 substr. MG1655)
RIBOPHOSPHAT-RXN [EC: 3.1.3.104]; RXN0-5187 [EC: 3.1.3.104, 3.1.3.102]

Predicted SEED Role

"Putative FMN hydrolase (EC 3.1.3.-); 5-Amino-6-(5'-phosphoribitylamino)uracil phosphatase" (EC 3.1.3.-)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (9/9 steps found)
• flavin biosynthesis III (fungi) (8/9 steps found)
• toxoflavin biosynthesis (4/7 steps found)
• flavin biosynthesis II (archaea) (6/10 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Ether lipid metabolism
• Fructose and mannose metabolism
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Riboflavin metabolism
• Sphingolipid metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.3.- or 3.1.3.102 or 3.1.3.104

Protein Sequence (238 amino acids)

>LU632_RS24130 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YigB (Erwinia tracheiphila SCR3)
MHFYRPLRPIAAMTFDLDDTLYDNRTVICRTTKESHTFLQSYHPALRDFSLQHYQQLRDG
LCKQEPEIYHDVTEWRRRTVELAMLNAGLSSQQSYEGSYKVMAHFSYWRSQVEVPDDTHS
TLNALAGRVPLVAITNGNAQPHRFGLDKYFQFILRAGPDGRAKPFHDMYHLAASRLKLSP
QQILHIGDDLTTDVAGSVRSGMQACWINLHKGNLMHIADSRLLPTLEISRLASLTALV