Protein Info for LU632_RS24115 in Erwinia tracheiphila SCR3

Name: corA
Annotation: magnesium/cobalt transporter CorA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 256 to 279 (24 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details TIGR00383: magnesium and cobalt transport protein CorA" amino acids 3 to 317 (315 residues), 359.9 bits, see alignment E=6.5e-112 PF01544: CorA" amino acids 28 to 313 (286 residues), 188.7 bits, see alignment E=7.8e-60

Best Hits

Swiss-Prot: 90% identical to CORA_YERPE: Magnesium transport protein CorA (corA) from Yersinia pestis

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 96% identity to ebi:EbC_02170)

MetaCyc: 87% identical to Ni2+/Co2+/Mg2+ transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-141; TRANS-RXN-141A; TRANS-RXN-141B

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>LU632_RS24115 magnesium/cobalt transporter CorA (Erwinia tracheiphila SCR3)
MLSAFKLDHSRLARLELDEPADELVSSVWVDLIEPEENERERVQRELGQSLATRPELEDI
EASARFFEDEDGLHIHSFFFYEDADDHAGNSTVAFTIREGRLYTLRERELPAFRLYRMRA
RNQTLIDGNAWELLLDLFETKIEQMADEIENIYSDLEKLSRVIMEGQQGDEFDAALSTLA
ELEDIGWKVRLCLMDTQRALNFLVRKARLPANQLEQAREILRDIESLLPHNESLFQKVNF
LMQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFEFMPELKWSFGYPGAIGLM
ILAGLAPYAYFKRKNWL