Protein Info for LU632_RS23995 in Erwinia tracheiphila SCR3

Name: ubiB
Annotation: ubiquinone biosynthesis regulatory protein kinase UbiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 500 to 518 (19 residues), see Phobius details amino acids 524 to 541 (18 residues), see Phobius details TIGR01982: 2-polyprenylphenol 6-hydroxylase" amino acids 7 to 445 (439 residues), 594.2 bits, see alignment E=6.1e-183 PF03109: ABC1" amino acids 93 to 343 (251 residues), 253.6 bits, see alignment E=7.6e-80

Best Hits

Swiss-Prot: 86% identical to UBIB_ERWT9: Probable protein kinase UbiB (ubiB) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K03688, ubiquinone biosynthesis protein (inferred from 89% identity to ebi:EbC_02350)

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (545 amino acids)

>LU632_RS23995 ubiquinone biosynthesis regulatory protein kinase UbiB (Erwinia tracheiphila SCR3)
MTFGELRRFYLIIHIFLSYGLDELIPITRLTLPVRLWRKCLFWMPNRHKKQPLGERLRLA
LEQLGPVWIKLGQMMSTRRDLFPPQIADQLALLQDRVAPFDGVKAQHQIELSLGCAIENY
FDDFVITPLASASIAQVHTATLKENGQQVVIKVIRPDILPVIKADMKLIKRMARWVPRLL
PDSRRLRPREVVADYEKNLIDELNLLREAANAIQLRRNFDNNKMLYIPEIFSDYCSETML
VMERIYGIPVNDVVQLEQHGVNLKLLAERGVQVFFTQVFRDSFFHADMHPGNIFVSYEHP
EDPQYIGIDCGIVGSLNKGDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEDFEF
AIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGLGRQLYP
QLDLWKTAKPFLEEWIKDQIGIPAIVRALKEKETFWAEKLPELPELFYDSLRQHKYLQRS
VEKLATDLKGERVRQHQSRYLFGAGAALLLSGTAILLTRPQWDLISAAMIAAGLVTWLVG
WRKIV