Protein Info for LU632_RS23970 in Erwinia tracheiphila SCR3

Name: rfaH
Annotation: transcription/translation regulatory transformer protein RfaH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02357: NusG
  • amino acids 3 to 93 (91 residues), 74.4 bits, E=4.3e-25
• TIGR01955: transcription elongation factor/antiterminator RfaH
  • amino acids 4 to 159 (156 residues), 205.3 bits, E=2.6e-65

Best Hits

Swiss-Prot: 71% identical to RFAH_ECOL6: Transcription antitermination protein RfaH (rfaH) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K05785, transcriptional antiterminator RfaH (inferred from 84% identity to ebi:EbC_02400)

Predicted SEED Role

"Transcriptional activator RfaH" in subsystem Transcription factors bacterial

Protein Sequence (162 amino acids)

>LU632_RS23970 transcription/translation regulatory transformer protein RfaH (Erwinia tracheiphila SCR3)
MESWYLLYCKRGQLLRAKEHLERQAVHCLSPMIAIEKMVRGKRTIVNEPLFPNYLFIEFD
PEAIHTTTISATRGVSHFVRFGSMPAIVPEGVIVALQTERTETLTDPDLPQPGEQVIITA
GAFEGLKAIFTEPDGEARSMLLLKMLNKQIVRSMDNKQFQKL