Protein Info for LU632_RS23875 in Erwinia tracheiphila SCR3

Name: dsbA
Annotation: thiol:disulfide interchange protein DsbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01323: DSBA
  • amino acids 40 to 188 (149 residues), 94.8 bits, E=6.1e-31
• PF13462: Thioredoxin_4
  • amino acids 40 to 183 (144 residues), 44.5 bits, E=2e-15

Best Hits

Swiss-Prot: 69% identical to DSBA_SHIFL: Thiol:disulfide interchange protein DsbA (dsbA) from Shigella flexneri

KEGG orthology group: K03673, thiol:disulfide interchange protein DsbA (inferred from 88% identity to ebi:EbC_00250)

MetaCyc: 69% identical to thiol:disulfide oxidoreductase DsbA (Escherichia coli K-12 substr. MG1655)
RXN-21426 [EC: 1.8.4.15]; 1.8.4.15 [EC: 1.8.4.15]

Predicted SEED Role

"Periplasmic thiol:disulfide interchange protein DsbA" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

MetaCyc Pathways

• periplasmic disulfide bond formation (1/3 steps found)
• cytochrome c biogenesis (system I type) (3/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.15

Protein Sequence (209 amino acids)

>LU632_RS23875 thiol:disulfide interchange protein DsbA (Erwinia tracheiphila SCR3)
MKKIFFALVGMLIVFSASAAQFTDGKEYVTLQKPVTGEPQVMEFFSFYCPHCYEFEHVWH
VSDAVKKNLPANTKVTKYHVEFLGGDMGKTVTQAWAVAMALGVEDKVTAPIFDGIQKTQT
ITDQASLKDVFVKSAGITPEQYDAAWNSFVVKSLVAQQEKAAEDVNLRGVPAVFVNGKYM
VNNDGLDTSSMDNYVQQYANVVKFLVAQK