Protein Info for LU632_RS23260 in Erwinia tracheiphila SCR3

Annotation: glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02798: GST_N
  • amino acids 4 to 73 (70 residues), 50.3 bits, E=4.8e-17
• PF13417: GST_N_3
  • amino acids 11 to 78 (68 residues), 47.1 bits, E=4.9e-16
• PF13409: GST_N_2
  • amino acids 12 to 74 (63 residues), 48.5 bits, E=2.1e-16
• PF00043: GST_C
  • amino acids 144 to 204 (61 residues), 24.7 bits, E=4.4e-09

Best Hits

Swiss-Prot: 35% identical to GST1_YEAST: Glutathione S-transferase 1 (GTT1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 81% identity to ebi:EbC_03550)

MetaCyc: 35% identical to glutathione transferase 1 monomer (Saccharomyces cerevisiae)
Glutathione transferase. [EC: 2.5.1.18]; 2.5.1.18 [EC: 2.5.1.18]

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (3/10 steps found)
• gliotoxin biosynthesis (1/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Protein Sequence (220 amino acids)

>LU632_RS23260 glutathione S-transferase (Erwinia tracheiphila SCR3)
MITVHHLNNSRSQRVLWMLEELELPYQIKQYQRENNMLAPQALKQIYPLGKSPIITDGNR
TIAESGAILEYLQERYDSENRFTLDDEEARLQARYWLHYAEGSLMPLLVMKLIFSRLGKP
PVPWLLRPVGGAFGKGVQKGYLDKQLATHRGFIEQHLAQNEWFAGSPFSIADVQMSFPLQ
ALASRGGAANSPAISAWLDKVKHRAAWQRAINKGGEISLE