Protein Info for LU632_RS23235 in Erwinia tracheiphila SCR3

Annotation: polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 signal peptide" amino acids 7 to 19 (13 residues), see Phobius details amino acids 31 to 31 (1 residues), see Phobius details transmembrane" amino acids 20 to 30 (11 residues), see Phobius details amino acids 42 to 64 (23 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 167 to 183 (17 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 286 to 309 (24 residues), see Phobius details amino acids 321 to 341 (21 residues), see Phobius details amino acids 353 to 372 (20 residues), see Phobius details amino acids 378 to 399 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 79% identity to ebi:EbC_03490)

Predicted SEED Role

"FIG00895657: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>LU632_RS23235 polysaccharide biosynthesis protein (Erwinia tracheiphila SCR3)
MRYSVLSNAAWMMSEKVVSVFSVIFVTSYVAKSFGPVIFGQIAFSASLFSIIQTIAIFGT
ETILFKNISKSTTRGIRLMAVATQLRITLLLSLSVPILIYIWITMRENFLIFAVASFLSA
IFVTQDIFSVYNNARLASRMNTFANSMGMVFSFALSYSIVWFRLSPLWLSLSIVSVTFLP
YLIKRNMFYQANSISPPPKRRQRSYLRHLFQAGLPLAISSVFIAVQVKLAQFFLVGVGSA
HQLGLFTAANTISTSWIFIPAAIITSSFAEIFRERTDIAEKLTARLYGYVMAISLLMLLV
VALFGKYLISKLYGQDYAESVSLVTLLSVATCFSAMGTIAYRYMIKEGGFNYLLVKIVFL
VTISVMTNWYFIRCWGLTGAAWSVLITELLSLTVMNYFFKNGVILKIQLSSLNYKTYKLR
QKC