Protein Info for LU632_RS23115 in Erwinia tracheiphila SCR3

Annotation: TolC family outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 22 to 432 (411 residues), 239.6 bits, see alignment E=3.2e-75 PF02321: OEP" amino acids 38 to 209 (172 residues), 64.1 bits, see alignment E=7.8e-22 amino acids 232 to 425 (194 residues), 88.1 bits, see alignment E=3.3e-29

Best Hits

KEGG orthology group: K12340, outer membrane channel protein TolC (inferred from 45% identity to cro:ROD_03721)

Predicted SEED Role

"Type I secretion outer membrane protein, TolC precursor" in subsystem Multidrug Resistance Efflux Pumps or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>LU632_RS23115 TolC family outer membrane protein (Erwinia tracheiphila SCR3)
MNIKRIGLLPAIICFHAFSTHAANLQQSVLAASYWDSEYRAAVELRDAEGQKRYQGFAGL
LPEISLSSTWYKQDQPGATYAAGIKHHNYSINLQQPLFDLSRYATWQRAEAAANAADATF
MLAQQKLIQNVASAYFGVLFTRKKLDTFQRESKGYKFQLEKAKQALAIGDGTQLDMDEAQ
ASYDRSNTDMLTAQDELSQAGIDFNRLTGLSADEIKEGDLQCLFQPVRENMDTVVKRAVQ
NNFNVVAALYHLEEARADVTAAAAAHLPVVSLQATYGNNWSRAENGNLLDEVFGTTSKTR
NTLIGVNVSVPLFAGGKMLSQSFEASSRRNQNLMLVEDARRKVAQQTTVSWLGLKNNLEK
IHSLKKLQHSSRKKLDSTIYGKEVGLRTLLDQFEAEKDLYRSIQDLAAAENKFLQTKIEL
DAATGELDYSTLNNYICY