Protein Info for LU632_RS23090 in Erwinia tracheiphila SCR3

Annotation: disulfide bond formation protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details PF02600: DsbB" amino acids 11 to 95 (85 residues), 43.1 bits, see alignment E=3e-15

Best Hits

KEGG orthology group: None (inferred from 75% identity to epy:EpC_31220)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>LU632_RS23090 disulfide bond formation protein B (Erwinia tracheiphila SCR3)
MQLTEKKDFSRMLNLLMLVLVSTALLCAFYFQLRFFDLPCPLCLLQRAALLLTGTGLLFN
LYFGNKKLHYGMVILGAIAVAAVACRHIFLHIVPGDKGYGLPFLGLHLYTWSFILAVAII
IGVAITLMITPDATTPATAKKSLIQHIIVAVFTLMMVGNFLSTLLECGGGQCDDNPTFYQ
LLK