Protein Info for LU632_RS22915 in Erwinia tracheiphila SCR3

Annotation: intracellular growth attenuator family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 712 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 205 to 222 (18 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 343 to 362 (20 residues), see Phobius details amino acids 655 to 677 (23 residues), see Phobius details PF07095: IgaA" amino acids 1 to 701 (701 residues), 1112.6 bits, see alignment E=0

Best Hits

Swiss-Prot: 63% identical to IGAA_YERPE: Putative membrane protein IgaA homolog (YPO0142) from Yersinia pestis

KEGG orthology group: None (inferred from 82% identity to ebi:EbC_41980)

Predicted SEED Role

"IgaA: a membrane protein that prevents overactivation of the Rcs regulatory system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (712 amino acids)

>LU632_RS22915 intracellular growth attenuator family protein (Erwinia tracheiphila SCR3)
MSAIVIILAVMLACSLGAGCFFWYAMRHRPPLAKPLPFISPPFRKLNDDERKAVEHYIDS
LEKHRSSVIPSGASGTTDHLVLSSQSSNVYPVTRSITRYGLSTDDPYKWRYYLDAVEVHL
PPHWEQYITDENFVELIKTQSIPLVISLNGHSLVNYAYEQPSLPPIVRPAGQNASIRQEE
SENIELIKMRKETRDEYALRRPDGTREAFAINIALLLIFFSLNGPSILMTWLIIAAITVI
LVSCWSLYRRPGEKDLKDIHSLRGAPKRWGLFGESNQGQVSNISLGIIDLIYPAHWQPWV
ANDLGQSTEVDIYLSRHVVRQGRFLSLQDEVRNFPVQRWRKNMVLAAGSLLVLLLLISWV
PLSMPLKLSMAWLKGTESVQVHSVGELDKTPLRVGDSLKVNGEGMCSIPALYQGNRSYNF
MPFDCSAIYWNTAAPLPQPQSDIIDKTTALLATTNQQLHPQNNTDQKLNPQLATAIQKSG
MILLDNFSDIVLRTQDLCSQAQDCIRLKNALVNLGNAKDWETLVHRADSGALNGMNVLLR
RVSAEALENLVNTATSSFFYRETRRAAEALNSPPPGGFVILSDEGKQLVSQQPPGVSLFD
YDAPEQWPELQRLAGMLLHTSFSASGIVTSITTDANGTRHIALHSEPDVLTLVRYLGNSL
LLVVSALSFIINSLLALKRIHRNRLRTSAIQSYYDKCFNHTPGSSEGIRPLF