Protein Info for LU632_RS22855 in Erwinia tracheiphila SCR3

Name: dam
Annotation: adenine-specific DNA-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 TIGR00571: DNA adenine methylase" amino acids 5 to 269 (265 residues), 324 bits, see alignment E=4.3e-101 PF02086: MethyltransfD12" amino acids 10 to 253 (244 residues), 265.9 bits, see alignment E=2.2e-83

Best Hits

Swiss-Prot: 72% identical to DMA_SALTY: DNA adenine methylase (dam) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K06223, DNA adenine methylase [EC: 2.1.1.72] (inferred from 83% identity to ebi:EbC_41870)

MetaCyc: 72% identical to DNA adenine methyltransferase (Escherichia coli K-12 substr. MG1655)
Site-specific DNA-methyltransferase (adenine-specific). [EC: 2.1.1.72]

Predicted SEED Role

"Methyl-directed repair DNA adenine methylase (EC 2.1.1.72)" in subsystem DNA repair, bacterial (EC 2.1.1.72)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>LU632_RS22855 adenine-specific DNA-methyltransferase (Erwinia tracheiphila SCR3)
MKKNRAFLKWAGGKFPLLDDIQRYLPEGDCLIEPFVGAGSVFLNTRFPRYMLADINSDLI
NLYEIVKTNVDQFVASARELFTKENNDADFYYARRKEFNQCCDLFRRAVLFLYLNRHCYN
GLCRYNLSGEFNVPFGRYHKPYFPEEELYWFAERSQNATFVCESYDASFNRAQQGAVIYC
DPPYAPLSTTANFTAYHTNSFSLRQQQHLAELAEKLARESCIPVLISNHDTPLTREWYQA
ARQLHQIKARRSISRNGSGRTQVQELLALFDGG