Protein Info for LU632_RS22845 in Erwinia tracheiphila SCR3

Annotation: phosphoglycolate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 transmembrane" amino acids 124 to 142 (19 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details PF00702: Hydrolase" amino acids 7 to 188 (182 residues), 107.2 bits, see alignment E=2.9e-34 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 10 to 222 (213 residues), 234.9 bits, see alignment E=1.1e-73 PF12710: HAD" amino acids 10 to 184 (175 residues), 41 bits, see alignment E=5.6e-14 PF13419: HAD_2" amino acids 10 to 192 (183 residues), 106.6 bits, see alignment E=3.1e-34 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 108 to 188 (81 residues), 35.1 bits, see alignment E=2.5e-12 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 130 to 193 (64 residues), 29.4 bits, see alignment E=1.2e-10 PF13242: Hydrolase_like" amino acids 149 to 219 (71 residues), 34.6 bits, see alignment E=2.9e-12

Best Hits

Swiss-Prot: 67% identical to GPH_YERPE: Phosphoglycolate phosphatase (gph) from Yersinia pestis

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 76% identity to ebi:EbC_41850)

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (232 amino acids)

>LU632_RS22845 phosphoglycolate phosphatase (Erwinia tracheiphila SCR3)
MAHFTEIRGVAFDLDGTLVDSAPGLADAIDATLTTLHLPAAGVARVSTWIGNGADIMIER
ALNWALGHKPTGDLHAEACTLFDKHYAVTVKTGSRLFPAVKENLAAMAASGIPMAIVTNK
PTAFIQPLLISSGISDYFSLVLGGDDVVMKKPHPAPIFLVLGTFGLLPAELLFVGDSRND
ILAAQAAGCPCTGMTYGYNYGEPVASSHPNLVLDHFNDLLPAIGLSSPGYHS