Protein Info for LU632_RS22705 in Erwinia tracheiphila SCR3
Name: tusD
Annotation: sulfurtransferase complex subunit TusD
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 74% identical to TUSD_ERWT9: Sulfurtransferase TusD (tusD) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)
KEGG orthology group: K07235, tRNA 2-thiouridine synthesizing protein D [EC: 2.8.1.-] (inferred from 79% identity to ebi:EbC_41400)MetaCyc: 71% identical to sulfurtransferase complex subunit TusD (Escherichia coli K-12 substr. MG1655)
2.8.1.-
Predicted SEED Role
"tRNA 5-methylaminomethyl-2-thiouridine synthase TusD"
MetaCyc Pathways
- tRNA-uridine 2-thiolation and selenation (bacteria) (7/11 steps found)
Isozymes
Compare fitness of predicted isozymes for: 2.8.1.-
Use Curated BLAST to search for 2.8.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (128 amino acids)
>LU632_RS22705 sulfurtransferase complex subunit TusD (Erwinia tracheiphila SCR3) MRFILMVTGPAYGTQQASSALLFAQALLEQGHVLESVFFYREGVLNANALTSPANDEFNL THGWQQLNQQQDVTLNICVSAALRRGIANEQEAKNLGLTCANLAEGFQLAGLGALAEAAL TCDRLVQF