Protein Info for LU632_RS22635 in Erwinia tracheiphila SCR3

Name: rpsS
Annotation: 30S ribosomal protein S19

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 92 TIGR01050: ribosomal protein uS19" amino acids 1 to 91 (91 residues), 151.1 bits, see alignment E=4e-49 PF00203: Ribosomal_S19" amino acids 3 to 83 (81 residues), 128.4 bits, see alignment E=3.7e-42

Best Hits

Swiss-Prot: 99% identical to RS19_PECCP: 30S ribosomal protein S19 (rpsS) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K02965, small subunit ribosomal protein S19 (inferred from 98% identity to kpe:KPK_0403)

MetaCyc: 97% identical to 30S ribosomal subunit protein S19 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S19p (S15e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (92 amino acids)

>LU632_RS22635 30S ribosomal protein S19 (Erwinia tracheiphila SCR3)
MPRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVHNGRQHVPV
FVSDEMVGHKLGEFAPTRTYRGHTADKKAKKR