Protein Info for LU632_RS21795 in Erwinia tracheiphila SCR3

Annotation: IS91 family transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 PF14319: Zn_Tnp_IS91" amino acids 17 to 106 (90 residues), 71.2 bits, see alignment E=5.9e-24 PF04986: Y2_Tnp" amino acids 144 to 324 (181 residues), 179.9 bits, see alignment E=5.3e-57

Best Hits

Swiss-Prot: 63% identical to T801_PSESH: Transposase for insertion sequence element IS801 from Pseudomonas savastanoi pv. phaseolicola

KEGG orthology group: None (inferred from 79% identity to ssn:SSON_P209)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>LU632_RS21795 IS91 family transposase (Erwinia tracheiphila SCR3)
MVSDFSPRPLKKLFTTNQCSASFLDAGGLRDIEVEAVTKMLACGTRISGVKEYACDNAQC
PHVRYITNACHSRACPSCGKKATDLWIAAQLNRLPDCDWQHLVFTLPDTLWALFEANRWL
LNDLCRLAVDNLLYAAGKRGLDIGIFCPIHTYSRRLNWHPHVHVSVTCGGIDEHGKWRKI
SFRKDAMRTRWMWNVRQRLLDAWSEGIALPVELMHITTDSQWRTLILTAGGQCWYVYMSK
KTAGSKNTVRYLGRYLKKPPIAGSRLAHYAGGATLSFRYHDHNTGQQATERLTQHEMVRR
LKQHIPEKHFRMVRYFGFLSKRVCGERLPQVYSALGMDKPDPAVKICYAQLSKQFLRRDP
FECVLCGGRMVYRRAVAGLNVQGLKIHARDISLMRYIPA