Protein Info for LU632_RS21705 in Erwinia tracheiphila SCR3

Annotation: Opacity-associated protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details PF08525: OapA_N" amino acids 26 to 53 (28 residues), 35.6 bits, see alignment 6.5e-13 PF04225: OapA" amino acids 100 to 183 (84 residues), 126.4 bits, see alignment E=3.7e-41

Best Hits

KEGG orthology group: K07269, hypothetical protein (inferred from 50% identity to eca:ECA3608)

Predicted SEED Role

"Putative cell envelope opacity-associated protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>LU632_RS21705 Opacity-associated protein A (Erwinia tracheiphila SCR3)
MSGLSLTEHITQWLRRIWFLPDSARWMDPLPSFHRRGIIFAAVVILMAFLWPSASPYQKP
GSLPNAQPTTTTPIMQAELSDRQGTSRQQLSSANADSQRQWHSYQIASGQTLAQLFRDHN
LPVNDVFAMAQVEGNDKPLSNLQSGQTVKIRQNDQGMVTDLTVESTNGQVLFTRQPDGSF
LRAQ