Protein Info for LU632_RS21290 in Erwinia tracheiphila SCR3

Name: ptsN
Annotation: PTS IIA-like nitrogen regulatory protein PtsN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01419: PTS IIA-like nitrogen-regulatory protein PtsN
  • amino acids 10 to 155 (146 residues), 195.7 bits, E=1.7e-62
• PF00359: PTS_EIIA_2
  • amino acids 14 to 155 (142 residues), 121.2 bits, E=1.7e-39

Best Hits

Swiss-Prot: 80% identical to PTSN_ECOLI: Nitrogen regulatory protein (ptsN) from Escherichia coli (strain K12)

KEGG orthology group: K02806, PTS system, nitrogen regulatory IIA component [EC: 2.7.1.69] (inferred from 94% identity to ebi:EbC_40400)

Predicted SEED Role

"PTS system nitrogen-specific IIA component, PtsN"

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Protein Sequence (161 amino acids)

>LU632_RS21290 PTS IIA-like nitrogen regulatory protein PtsN (Erwinia tracheiphila SCR3)
MMNNELTLELSSVLSLSCTRNDVHCQSKKRALEIISELAAKQLNLPHQTIFDAILTRERM
GSTGIGNGIAIPHGKLVEDTLRAVGVFIRLDQPVAFDAIDNQPVDLLFALLVPADQCKTH
LHTLSLVAKRLADKTVCRRLRAAQSDEELFEIMAESPDESH