Protein Info for LU632_RS21235 in Erwinia tracheiphila SCR3

Name: mlaD
Annotation: outer membrane lipid asymmetry maintenance protein MlaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR04430: outer membrane lipid asymmetry maintenance protein MlaD
  • amino acids 3 to 152 (150 residues), 173.2 bits, E=1.5e-55
• PF02470: MlaD
  • amino acids 39 to 116 (78 residues), 69.2 bits, E=1.4e-23

Best Hits

Swiss-Prot: 64% identical to MLAD_ECOLI: Intermembrane phospholipid transport system binding protein MlaD (mlaD) from Escherichia coli (strain K12)

KEGG orthology group: K02067, putative ABC transport system substrate-binding protein (inferred from 82% identity to ebi:EbC_40290)

Predicted SEED Role

"Uncharacterized ABC transporter, periplasmic component YrbD"

Protein Sequence (186 amino acids)

>LU632_RS21235 outer membrane lipid asymmetry maintenance protein MlaD (Erwinia tracheiphila SCR3)
MQTKKSEILVGAFLLLALAAALFLCLRVADLKSLGSEPTWRLYATFNNIGGLKIGSPVKI
GGVVIGRVTNIGLDSKTYSPRITMNINDKYKQLPDTSSLAIRTSGLLGEQFLALNVGFDD
PEMGTSMLKDGSTLQDTKSAMVLEDLIGQFIYKSGNTNNDKNASAAAEDANGKSAPTATV
HSDEGK