Protein Info for LU632_RS20985 in Erwinia tracheiphila SCR3
Annotation: YhbP family protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.
Best Hits
Swiss-Prot: 56% identical to YHBP_ESCF3: UPF0306 protein YhbP (yhbP) from Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
KEGG orthology group: K09979, hypothetical protein (inferred from 70% identity to ebi:EbC_39900)Predicted SEED Role
"FIG01219785: hypothetical protein"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (142 amino acids)
>LU632_RS20985 YhbP family protein (Erwinia tracheiphila SCR3) MDDSQTLNAITCFLQKQHVLSVCGGTPVWCANCFYRFDPLRVAFWIMTESKTRHGMQFYN DPQVAGTVNGQPKSVLKIQGVQYSGKISLLEGEAQEHAYKAYVKRFPVATKVSAPLWEIW IDELKMTDNTLGFGKKLSWQRA