Protein Info for LU632_RS20345 in Erwinia tracheiphila SCR3

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 55 to 75 (21 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 238 to 264 (27 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details amino acids 308 to 325 (18 residues), see Phobius details PF01032: FecCD" amino acids 17 to 326 (310 residues), 318.5 bits, see alignment E=2e-99

Best Hits

Swiss-Prot: 66% identical to HMUU_YERPE: Hemin transport system permease protein HmuU (hmuU) from Yersinia pestis

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 77% identity to ebi:EbC_37620)

MetaCyc: 41% identical to ferric citrate ABC transporter membrane subunit FecD (Escherichia coli K-12 substr. MG1655)
ABC-9-RXN [EC: 7.2.2.18]

Predicted SEED Role

"Hemin ABC transporter, permease protein" in subsystem Hemin transport system or Iron acquisition in Vibrio or Putative hemin transporter

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>LU632_RS20345 iron ABC transporter permease (Erwinia tracheiphila SCR3)
MKTVNVKRALLGMLIVMLAMMVLAANTGAMRLSLVTLWQAPFDSMEWQIWLNIRLPRVLL
AVLVGAALALSGATMQGLFRNPLADPGLLGISSGAALMLAFAVVLPVTLPAVLALWWPML
AAFAGSLVVTMIIFILSRHRSITLSRLLLAGIAINALCGAAVGVLSWISNDQQLRQLSLW
GMGSLGQAQWPTLLACAVLVLPTMLAIQWQAGRLNLLQLGDEEAHYLGVDVRRTQHKLLI
FSALMVAAAVAVSGIISFVGLVVPHLIRLWVGGDHRWLLPGSTLLGAILILVADTLARTV
VAPAEMPVGLLTSMLGAPWFLWLILRRPGGHR