Protein Info for LU632_RS19510 in Erwinia tracheiphila SCR3

Name: birA
Annotation: bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR00122: biotin operon repressor" amino acids 6 to 76 (71 residues), 94.5 bits, see alignment E=2.8e-31 PF08279: HTH_11" amino acids 13 to 58 (46 residues), 43.2 bits, see alignment 4.4e-15 TIGR00121: biotin--[acetyl-CoA-carboxylase] ligase" amino acids 82 to 317 (236 residues), 246.4 bits, see alignment E=2.9e-77 PF03099: BPL_LplA_LipB" amino acids 84 to 208 (125 residues), 100.6 bits, see alignment E=9.9e-33 PF02237: BPL_C" amino acids 271 to 317 (47 residues), 43.1 bits, see alignment 4.7e-15

Best Hits

Swiss-Prot: 75% identical to BIRA_SALTY: Bifunctional ligase/repressor BirA (birA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03524, BirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC: 6.3.4.15] (inferred from 84% identity to ebi:EbC_02500)

MetaCyc: 74% identical to DNA-binding transcriptional repressor/biotin-[acetyl-CoA-carboxylase] ligase BirA (Escherichia coli K-12 substr. MG1655)
Biotin--[acetyl-CoA-carboxylase] ligase. [EC: 6.3.4.15]

Predicted SEED Role

"Biotin--protein ligase (EC 6.3.4.9, EC 6.3.4.10, EC 6.3.4.11, EC 6.3.4.15) / Biotin operon repressor" in subsystem Biotin biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>LU632_RS19510 bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA (Erwinia tracheiphila SCR3)
MKANTVPLTLIGLLADGEFHSGEQLGEQLGMSRAAINKHIQTLKDWGIDVFTVVGKGYSL
SAPMQLLNEQQIARQLDDGRLTVIPVIDSTNQYLLDRMDELQSGDACVAEYQQAGRGRRG
RQWFSPFGSNLYLSMYWRLEDGPIAAMGLSLVIGIVTAEVLQQSGANDVRVKWPNDLYLK
DRKLAGILVELMGKTGDTAHIVIGTGINLVMQSPDPAVVNQGWINLRDAGVKIDRNLLAA
KLVNSMRQSLALFEREGLAPFIERWKALDNFIDRPVKLLIGDREIPGIARGIDQQGGLLL
EQDGVVKSWVGGEISLRLLAKQ