Protein Info for LU632_RS18955 in Erwinia tracheiphila SCR3

Name: rdgC
Annotation: recombination-associated protein RdgC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04381: RdgC
  • amino acids 2 to 300 (299 residues), 412.3 bits, E=6.1e-128

Best Hits

Swiss-Prot: 87% identical to RDGC_ERWT9: Recombination-associated protein RdgC (rdgC) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K03554, recombination associated protein RdgC (inferred from 92% identity to ebi:EbC_09550)

Predicted SEED Role

"DNA recombination-dependent growth factor C" in subsystem CBSS-562.2.peg.5158 SK3 including or DNA repair, bacterial

Protein Sequence (303 amino acids)

>LU632_RS18955 recombination-associated protein RdgC (Erwinia tracheiphila SCR3)
MLWFKNLMVYRLNRELPLAVDEMEKQLEAFTFTPCGSQDMAKTGWVSPMGPRGDALTHVN
NGQILICARKEEKILPSPVIKQTLDAKISKLEAEQQRKLKKTEKDSLKDEVLHSLLPRAF
SRFSQTFLWIDSVNNLVVVDCANAKKAEDTLALLRKSLGSLPVVPLTLESPIELTMTEWV
RSGTTPASFALMDEAELKSLLEDGGVIRCKKQDLVCDEIANHIEAGKLVTKLALDWQERV
QMVLYNDGSLKRLKFADTLREQNDDIDREDVAARFDADFILMTSELAALVSNTIEALGGE
AQR