Protein Info for LU632_RS18830 in Erwinia tracheiphila SCR3

Name: dxs
Annotation: 1-deoxy-D-xylulose-5-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13292: DXP_synthase_N
  • amino acids 16 to 282 (267 residues), 393.6 bits, E=9e-122
• TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase
  • amino acids 16 to 620 (605 residues), 995.8 bits, E=3.9e-304
• PF00676: E1_dh
  • amino acids 123 to 186 (64 residues), 24.6 bits, E=2.4e-09
• PF02779: Transket_pyr
  • amino acids 320 to 480 (161 residues), 156.8 bits, E=9e-50
• PF02780: Transketolase_C
  • amino acids 495 to 611 (117 residues), 84.7 bits, E=9.8e-28

Best Hits

Swiss-Prot: 88% identical to DXS_ERWT9: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 90% identity to ebi:EbC_09910)

MetaCyc: 82% identical to 1-deoxy-D-xylulose-5-phosphate synthase (Escherichia coli K-12 substr. MG1655)
1-deoxy-D-xylulose-5-phosphate synthase. [EC: 2.2.1.7]

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (12/12 steps found)
• superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
• taxadiene biosynthesis (engineered) (12/13 steps found)
• methylerythritol phosphate pathway I (9/9 steps found)
• methylerythritol phosphate pathway II (9/9 steps found)
• pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
• isoprene biosynthesis I (9/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (6/6 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (8/12 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.7

Protein Sequence (621 amino acids)

>LU632_RS18830 1-deoxy-D-xylulose-5-phosphate synthase (Erwinia tracheiphila SCR3)
MSFDTAKYPTLALAISVQELRTLPKESLPKLCDELRQYLLDSVSRSSGHFASGLGVVELT
IALHYVYNTPFDRLVWDVGHQAYPHKILTGRRDRIGTIRQKNGLHPFPWRDESEYDVLNV
GHSSTSISAGLGMAVAAQKEGKGRRTACIIGDGAITAGMAFEAMNHAGDIKPDMLVILND
NEMSISENVGALNNRLAQILSGKTYSRLREGGKKVLTNLPPIKELVKRTEEHLKGMVAPG
TLFEELGFNYIGPVDGHDVLSLVHTLNNMRELKGPQFLHIMTKKGKGYAPAEKDPISWHA
VPKFDPASGLLPKAAEGLPSYSKIFGQWLSETAKIDANLMAITPAMREGSGMVSFSRDYP
AQYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQLIHDVAIQKLPVLFAIDR
GGIVGSDGQTHQGAFDLSFLRCIPNMTIMTPSDEDECRQMLYTGYHHSDGPSAVRYPRGS
GTGAELKPLRALPLGKAVVKRRGKKLAILNFGTLLPEATSVAGSLDATLVDMRFVKPLDE
ALILELAAAHEALITLEEGAIKGGAGSGVIEFMMAKRCCVPVLTIGLPDEFIPQGTQEEI
RHDYRLDAPGIEHQIRYWLAQ