Protein Info for LU632_RS18705 in Erwinia tracheiphila SCR3

Annotation: Mu-like prophage major head subunit gpT family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF10124: Mu-like_gpT" amino acids 9 to 307 (299 residues), 430.2 bits, see alignment E=3.9e-133

Best Hits

Swiss-Prot: 58% identical to CAPSD_BPMU: Major capsid protein (T) from Escherichia phage Mu

KEGG orthology group: None (inferred from 87% identity to xne:XNC1_3383)

Predicted SEED Role

"Phage major capsid protein" in subsystem Phage capsid proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>LU632_RS18705 Mu-like prophage major head subunit gpT family protein (Erwinia tracheiphila SCR3)
MAIVTPALIKALFTGWNGDFQNGLEQADSQYEKIATIVPSTTKSNTYGWLGQFPGMREWI
GDRVIKDMQAHGYQLVNRPFESTVGVNRDDIDDDNVGIYSPLFTEMGRAAGVQPDELTFG
ALSQGFDTLCYDRQNFFDTDHPVYPAVDGTGTAASVSNILAAEGYKGQPWFVLDCSRAIK
PVIFQNRKSPELVAMDKVDDEDNFMRKLIRYGVDTRCEAGYSFWQLAYAAKAPLNADNVW
QVIQSMRSVRADGGRPLAIRPTHLVVPPSMEKQATQLLERELTIDSDGGTVSNEMKGRLE
LIVGDYL