Protein Info for LU632_RS18625 in Erwinia tracheiphila SCR3

Annotation: tail fiber assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 PF02413: Caudo_TAP" amino acids 78 to 197 (120 residues), 111.2 bits, see alignment E=2.2e-36

Best Hits

Swiss-Prot: 62% identical to TFAE_ECOLI: Prophage tail fiber assembly protein homolog TfaE (tfaE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 64% identity to cro:ROD_09031)

Predicted SEED Role

"Phage tail fiber assembly protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>LU632_RS18625 tail fiber assembly protein (Erwinia tracheiphila SCR3)
MATAKLNSELISIEAGDITVFNYDGGTREYLSTSVEYLAPGVGVPANSCTDAPGKSKDGF
AICRTVDFTAWEYVADHRGETVYNIKTGEEVAVTVPGDYPEGTTTLAPATPYDRWNGSEW
ITDYETQHIADVKAAEQQKAVLLAEAQATISLWQTELQLGIISDEDKASLVVWLRYIKAV
QAVDTSKAPDIIWPVRPV