Protein Info for LU632_RS18615 in Erwinia tracheiphila SCR3

Name: pgpA
Annotation: phosphatidylglycerophosphatase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 59 to 75 (17 residues), see Phobius details amino acids 96 to 122 (27 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details PF04608: PgpA" amino acids 24 to 161 (138 residues), 150.3 bits, see alignment E=1.7e-48

Best Hits

Swiss-Prot: 84% identical to PGPA_ECOLI: Phosphatidylglycerophosphatase A (pgpA) from Escherichia coli (strain K12)

KEGG orthology group: K01095, phosphatidylglycerophosphatase A [EC: 3.1.3.27] (inferred from 92% identity to ebi:EbC_09880)

MetaCyc: 84% identical to phosphatidylglycerophosphatase A (Escherichia coli K-12 substr. MG1655)
Phosphatidylglycerophosphatase. [EC: 3.1.3.27]

Predicted SEED Role

"Phosphatidylglycerophosphatase A (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.27

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>LU632_RS18615 phosphatidylglycerophosphatase A (Erwinia tracheiphila SCR3)
MIILPVSKDAAKRRLKMSNPWHLLATGFGSGLCPWVPGTVGSLASIPFWCLMTLLPQDLY
SLVVMFGICIGVYLCHRTAKDMGVHDHGCIVWDEFIGMWITLMAIPVNSWQWVLAGFVIF
RILDIWKPWPIRWFDRNVHGGMGIMIDDIIAGIISAGILYIAGHHLVM