Protein Info for LU632_RS18390 in Erwinia tracheiphila SCR3

Annotation: cytochrome o ubiquinol oxidase subunit IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02847: cytochrome o ubiquinol oxidase subunit IV
  • amino acids 12 to 107 (96 residues), 134.4 bits, E=7.7e-44
• PF03626: COX4_pro
  • amino acids 19 to 92 (74 residues), 68 bits, E=3.8e-23

Best Hits

Swiss-Prot: 73% identical to CYOD_SHIFL: Cytochrome bo(3) ubiquinol oxidase subunit 4 (cyoD) from Shigella flexneri

KEGG orthology group: K02300, cytochrome o ubiquinol oxidase operon protein cyoD (inferred from 94% identity to ebi:EbC_10000)

MetaCyc: 73% identical to cytochrome bo3 subunit 4 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit IV (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer II (1/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (1/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Protein Sequence (109 amino acids)

>LU632_RS18390 cytochrome o ubiquinol oxidase subunit IV (Erwinia tracheiphila SCR3)
MSHSVNQHGASHGSVKSYMIGFILSIILTAIPFWMVMDGTASKATILGVVLVCAVVQVLV
HLVYFLHLNTSSEERWNLVAIVFAAIIILIVVVGSLWIMWNLNYNMMAN