Protein Info for LU632_RS18375 in Erwinia tracheiphila SCR3

Name: cyoA
Annotation: cytochrome o ubiquinol oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 43 to 67 (25 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details TIGR01433: ubiquinol oxidase, subunit II" amino acids 13 to 239 (227 residues), 401.7 bits, see alignment E=4e-125 PF00116: COX2" amino acids 147 to 219 (73 residues), 27.8 bits, see alignment E=2e-10 PF06481: COX_ARM" amino acids 242 to 283 (42 residues), 49.6 bits, see alignment 2.8e-17

Best Hits

Swiss-Prot: 73% identical to CYOA_ECOL6: Cytochrome bo(3) ubiquinol oxidase subunit 2 (cyoA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02297, cytochrome o ubiquinol oxidase subunit II [EC: 1.10.3.-] (inferred from 90% identity to ebi:EbC_10030)

MetaCyc: 73% identical to cytochrome bo3 subunit 2 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>LU632_RS18375 cytochrome o ubiquinol oxidase subunit II (Erwinia tracheiphila SCR3)
MRLMKYNKSLGILSSIAGTLMLSGCDNALLNPKGQVALEQRSLILTAFGLMLIVVIPAVL
MALVFAWKYRASNTNAKYSPNWSHSNKVEAVVWTVPILIILFLGVLTWKSTHSLEPSKPL
VSNVKPIEIDVVALDWKWLFIYPEQGIATVNQIAFPANTPVNFKITSNTVMNSFFIPTLG
SQIYAMAGMQTKLHLIANEAGTFDGISANFSGRGFSGMKFKAIATPDQASFDQWVAKAKT
SSGQMMTMDDFEKLATPSENNPVEFFSTANPELFKKVIGKFKMSHGKIGMSGHEGMDMSE
VSQAGAEE