Protein Info for LU632_RS18180 in Erwinia tracheiphila SCR3

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00529: CusB_dom_1" amino acids 38 to 362 (325 residues), 49.8 bits, see alignment E=5.2e-17 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 41 to 376 (336 residues), 266.5 bits, see alignment E=1.4e-83 PF16576: HlyD_D23" amino acids 65 to 294 (230 residues), 48.4 bits, see alignment E=1.5e-16 PF13437: HlyD_3" amino acids 176 to 291 (116 residues), 38.3 bits, see alignment E=3.9e-13

Best Hits

Swiss-Prot: 72% identical to ACRA_ECOLI: Multidrug efflux pump subunit AcrA (acrA) from Escherichia coli (strain K12)

KEGG orthology group: K03585, membrane fusion protein (inferred from 85% identity to ebi:EbC_10370)

MetaCyc: 72% identical to multidrug efflux pump membrane fusion lipoprotein AcrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1551; TRANS-RXN-1552; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-356; TRANS-RXN-357; TRANS-RXN-359; TRANS-RXN-360; TRANS-RXN0-592

Predicted SEED Role

"Membrane fusion protein of RND family multidrug efflux pump" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>LU632_RS18180 efflux RND transporter periplasmic adaptor subunit (Erwinia tracheiphila SCR3)
MNKNRGLIPLAAVLILSGSMLLTGCDNKSTQQAGQQQAPEVGVVTLKTAPLTVTTDLPGR
TSSFRIAEVRPQVSGIILKRNFVEGSDIKAGESLYQIEPATYQAAYDSAKGDLAQAQANA
EIAALTVKRYKPLLGTKYISQQDYDTAVATASQTAAAVEVAKASVETARINLTFTKVTSP
INGRIGRSSVTEGALVQNAQTTALATVQQLDPIYVDVTQSSEDYTRLRAELRSGKLQQTG
GKAQVKLLLQNGSEYSQTGTLEFSDVTVDETTGSITLRAVFPNPGHTLLPGMFVRARLNE
GTNPNALLVPQQAVTRTPTGQATAMVVEADNKVAVRNLTAEQAIGDKWLVTDGLKAGDKV
ITTGIQRAKPGIQVTPQEVSTDNADKAKSVHAQS