Protein Info for LU632_RS17815 in Erwinia tracheiphila SCR3

Annotation: bifunctional tRNA (adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA large subunit methyltransferase RlmN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00048: 23S rRNA (adenine(2503)-C(2))-methyltransferase
  • amino acids 20 to 376 (357 residues), 568.9 bits, E=1.9e-175
• PF21016: RlmN_N
  • amino acids 25 to 84 (60 residues), 108.6 bits, E=9.8e-36
• PF04055: Radical_SAM
  • amino acids 127 to 300 (174 residues), 58.7 bits, E=8.8e-20

Best Hits

Swiss-Prot: 91% identical to RLMN_ERWT9: Dual-specificity RNA methyltransferase RlmN (rlmN) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K06941, ribosomal RNA large subunit methyltransferase N [EC: 2.1.1.-] (inferred from 91% identity to epy:EpC_10430)

MetaCyc: 89% identical to 23S rRNA m2A2503 methyltransferase/tRNA m2A37 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11586 [EC: 2.1.1.192]; 2.1.1.- [EC: 2.1.1.192]

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.192

Protein Sequence (391 amino acids)

>LU632_RS17815 bifunctional tRNA (adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA large subunit methyltransferase RlmN (Erwinia tracheiphila SCR3)
MSEHNVTSSSAPSAIAVAEAKKEKINLLDLNRQQMREFFVSLGEKPFRADQVMKWIYHYC
CDDFDQMTDINKVFRGKLKALAEIRAPEVAEEQRSADGTIKWAISVGGQQVETVYIPEKD
RATLCVSSQVGCALECKFCSTAQQGFNRNLRVSEIIGQVWRAAKIIGASKITGQRPITNV
VMMGMGEPLLNLNNVVPAMEIMLDDFGFGLSKRRVTLSTSGVVPALDKLGDVIDVALAIS
LHAPNDTIRDEIVPINKKYNIATFLDAVSRYIAKSNANQGRVTIEYVMLDHVNDSTDNAH
ELAALLKDTPCKINLIPWNPFPGAPYGRSSNSRIDRFSKVLMDYGFTTIVRKTRGDDIDA
ACGQLAGEVIDRTRRTMRKKMAGEPISVKAL