Protein Info for LU632_RS17785 in Erwinia tracheiphila SCR3

Name: bamB
Annotation: outer membrane protein assembly factor BamB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR03300: outer membrane assembly lipoprotein YfgL" amino acids 9 to 391 (383 residues), 445 bits, see alignment E=8.8e-138 PF13360: PQQ_2" amino acids 78 to 320 (243 residues), 195.2 bits, see alignment E=2e-61 amino acids 289 to 391 (103 residues), 44.1 bits, see alignment E=3e-15 PF13570: PQQ_3" amino acids 89 to 139 (51 residues), 19.7 bits, see alignment 1.4e-07 amino acids 140 to 177 (38 residues), 28.2 bits, see alignment 3e-10 amino acids 246 to 275 (30 residues), 19.6 bits, see alignment (E = 1.5e-07) amino acids 276 to 311 (36 residues), 19.2 bits, see alignment 2e-07 amino acids 317 to 353 (37 residues), 18.4 bits, see alignment 3.7e-07 PF01011: PQQ" amino acids 123 to 157 (35 residues), 26.2 bits, see alignment 7.2e-10 amino acids 257 to 286 (30 residues), 25.6 bits, see alignment (E = 1.1e-09)

Best Hits

Swiss-Prot: 78% identical to BAMB_SALTY: Outer membrane protein assembly factor BamB (bamB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 87% identity to ebi:EbC_33730)

Predicted SEED Role

"Outer membrane protein YfgL, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>LU632_RS17785 outer membrane protein assembly factor BamB (Erwinia tracheiphila SCR3)
MELRKILLPGLISVTLLSGCSWFSGEEDVVKMSPLPKVENQFTPQQVWNVSVGDGVGDFY
SNLPPGWSDGTVYAADRFGVVKAVNMADGKEQWNVNLSEKTGFFSKNLSALLSGGVTVDG
EHLYLGSERAQVYALNTRDGSVAWQTKAAGEILSRPVISDGLVLVHTSNGMLQGLDQSSG
VVKWTVNLDVPSLSLRGESAPATAFGAAIVGGDNGRVSAVMMNQGQIIWQQRISQPTGAT
EIDRLADVDTTPVIVNGVVYALAYNGNLAALDLRSGQIIWKREIGSVHDMIVDGGRIYLV
DQDDRVIAVSTEGGVTVWRQSDLLHRNLTSPALYNGYLVVGDSEGYLHWLNTTDGRFVAQ
QKVDSSGFQTEPVLASDKLLIQAKGGKVYAITR