Protein Info for LU632_RS17750 in Erwinia tracheiphila SCR3

Name: guaA
Annotation: glutamine-hydrolyzing GMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 11 to 206 (196 residues), 270.2 bits, E=6.8e-85
• PF00117: GATase
  • amino acids 12 to 200 (189 residues), 150.9 bits, E=8.8e-48
• PF07722: Peptidase_C26
  • amino acids 77 to 184 (108 residues), 34.2 bits, E=5.7e-12
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 213 to 526 (314 residues), 506.2 bits, E=3.4e-156
• PF02540: NAD_synthase
  • amino acids 216 to 255 (40 residues), 27.3 bits, 4.8e-10
• PF03054: tRNA_Me_trans
  • amino acids 230 to 262 (33 residues), 20.9 bits, see alignment (E = 6.2e-08)
• PF00958: GMP_synt_C
  • amino acids 434 to 525 (92 residues), 145.4 bits, E=1.1e-46

Best Hits

Swiss-Prot: 90% identical to GUAA_CROS8: GMP synthase [glutamine-hydrolyzing] (guaA) from Cronobacter sakazakii (strain ATCC BAA-894)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 92% identity to ebi:EbC_33660)

MetaCyc: 88% identical to GMP synthetase (Escherichia coli K-12 substr. MG1655)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]; 6.3.5.2 [EC: 6.3.5.2]

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (8/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Protein Sequence (526 amino acids)

>LU632_RS17750 glutamine-hydrolyzing GMP synthase (Erwinia tracheiphila SCR3)
MTTENIHKHRILILDFGSQYTQLVARRVRELGVYCELWAWDVTEEQIRQFNPNGIILSGG
PESTTENGSPRSPAYVFEAGVPVLGVCYGMQTMALQLGGKVSCSSEREYGYAQVEIAVES
ALTHNIEDSLSTSGKPVLDVWMSHGDKVTAIPADFVTVASTETCPFAIIANEEKRLYGVQ
FHPEVTHTRQGLRLLERFIRDICHCEALWTPAKIIEDAVERLREQVGNDKVILGLSGGVD
SSVTALLLHRAIGDHLTCVFVDNGLLRLNEAGQVMDMFGDRFGLNIVHVPAEARFLDALA
GIDDPEAKRKTIGRVFVEVFDEQATRLTDVSWLAQGTIYPDVIESAASATGKAHVIKSHH
NVGGLPKEMKLGLVEPLKELFKDEVRKIGLELGLPYDMLFRHPFPGPGLGVRVLGEVKKE
YCDLLRRADAIFIEELRKAELYDKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETID
FMTAHWAHLPYEFLGRVSNRIINEINGISRVVYDISGKPPATIEWE